Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q9NP73: Variant p.Asn107Ser

Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13
Gene: ALG13
Feedback?
Variant information Variant position: help 107 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Asparagine (N) to Serine (S) at position 107 (N107S, p.Asn107Ser). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and polar (N) to small size and polar (S) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In DEE36; de novo mutation detected in unrelated patients. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 107 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1137 The length of the canonical sequence.
Location on the sequence: help LETLEKGKPLVVVINEKLMN N HQLELAKQLHKEGHLFYCTC The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         LETLEKGKPLVVVINEKLMNNHQLELAKQLHKEGHLFYC--TC

Mouse                         LESLEKGKPLVVVVNEKLMNNHQFELAKQLHKEGHLFYC--

Rat                           LESLEKGKPLVVVVNEKLMNNHQFELAKQLHKEGHLFYC--

Baker's yeast                 LDSLRLNKPLIVCVNDSLMDNHQQQIADKFVELGYVWSCAP

Fission yeast                 LQTLRSGKRLLVVPNESLMDNHQVELATKLASMNYLVTC--
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 1137 Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13
Region 1 – 125 Glycosyltransferase activity



Literature citations
De novo mutations in epileptic encephalopathies.
Allen A.S.; Berkovic S.F.; Cossette P.; Delanty N.; Dlugos D.; Eichler E.E.; Epstein M.P.; Glauser T.; Goldstein D.B.; Han Y.; Heinzen E.L.; Hitomi Y.; Howell K.B.; Johnson M.R.; Kuzniecky R.; Lowenstein D.H.; Lu Y.F.; Madou M.R.; Marson A.G.; Mefford H.C.; Esmaeeli Nieh S.; O'Brien T.J.; Ottman R.; Petrovski S.; Poduri A.; Ruzzo E.K.; Scheffer I.E.; Sherr E.H.; Yuskaitis C.J.; Abou-Khalil B.; Alldredge B.K.; Bautista J.F.; Berkovic S.F.; Boro A.; Cascino G.D.; Consalvo D.; Crumrine P.; Devinsky O.; Dlugos D.; Epstein M.P.; Fiol M.; Fountain N.B.; French J.; Friedman D.; Geller E.B.; Glauser T.; Glynn S.; Haut S.R.; Hayward J.; Helmers S.L.; Joshi S.; Kanner A.; Kirsch H.E.; Knowlton R.C.; Kossoff E.H.; Kuperman R.; Kuzniecky R.; Lowenstein D.H.; McGuire S.M.; Motika P.V.; Novotny E.J.; Ottman R.; Paolicchi J.M.; Parent J.M.; Park K.; Poduri A.; Scheffer I.E.; Shellhaas R.A.; Sherr E.H.; Shih J.J.; Singh R.; Sirven J.; Smith M.C.; Sullivan J.; Lin Thio L.; Venkat A.; Vining E.P.; Von Allmen G.K.; Weisenberg J.L.; Widdess-Walsh P.; Winawer M.R.;
Nature 501:217-221(2013)
Cited for: INVOLVEMENT IN DEE36; VARIANT DEE36 SER-107; Whole-exome sequencing improves the diagnosis yield in sporadic infantile spasm syndrome.
Dimassi S.; Labalme A.; Ville D.; Calender A.; Mignot C.; Boutry-Kryza N.; de Bellescize J.; Rivier-Ringenbach C.; Bourel-Ponchel E.; Cheillan D.; Simonet T.; Maincent K.; Rossi M.; Till M.; Mougou-Zerelli S.; Edery P.; Saad A.; Heron D.; des Portes V.; Sanlaville D.; Lesca G.;
Clin. Genet. 89:198-204(2016)
Cited for: INVOLVEMENT IN DEE36; VARIANT DEE36 SER-107; Diagnostic exome sequencing in persons with severe intellectual disability.
de Ligt J.; Willemsen M.H.; van Bon B.W.; Kleefstra T.; Yntema H.G.; Kroes T.; Vulto-van Silfhout A.T.; Koolen D.A.; de Vries P.; Gilissen C.; del Rosario M.; Hoischen A.; Scheffer H.; de Vries B.B.; Brunner H.G.; Veltman J.A.; Vissers L.E.;
N. Engl. J. Med. 367:1921-1929(2012)
Cited for: VARIANT DEE36 SER-107; De novo mutations in SLC1A2 and CACNA1A are important causes of epileptic encephalopathies.
Epi4K Consortium;
Am. J. Hum. Genet. 99:287-298(2016)
Cited for: VARIANT DEE36 SER-107;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.