UniProtKB/Swiss-Prot P08571: Variant p.Glu341Lys

Monocyte differentiation antigen CD14
Gene: CD14
Feedback?

Variant information Variant position:

341 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Glutamate (E) to Lysine (K) at position 341 (E341K, p.Glu341Lys). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from medium size and acidic (E) to large size and basic (K) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Other resources:

Links to websites of interest for the variant.

Variant rs11556179 [ dbSNP | Ensembl ]

Sequence information Variant position:

341 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

375 The length of the canonical sequence.
Location on the sequence:

VDNLTLDGNPFLVPGTALPH E GSMNSGVVPACARSTLSVGV The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         VDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGV

Mouse                         VGNLSLKGNPFLD---SESHSEKFNSGVVTAGAPSSQAVAL

Rat                           VGSLSLTGNPFLH---SESQSEAYNSGVVIATALSPGSAGL

Bovine                        VNDLTLDGNPFLDPGALQHQNDPMISGVVPACARSALTMGV

Rabbit                        VVNLSLDGNPFLVPGASKLQEDLTNSGVFPACPPSPLAMGM

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	20 – 367	Monocyte differentiation antigen CD14, urinary form
Chain	20 – 345	Monocyte differentiation antigen CD14, membrane-bound form
Repeat	322 – 349	LRR 11
Region	290 – 375	Required for response to bacterial lipopolysaccharide (LPS)
Lipidation	345 – 345	GPI-anchor amidated asparagine
Glycosylation	323 – 323	N-linked (GlcNAc...) asparagine
Glycosylation	336 – 336	O-linked (GalNAc...) threonine

Literature citations
No reference for the current variant in UniProtKB/Swiss-Prot.

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.