Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P04637: Variant p.Leu323Val

Cellular tumor antigen p53
Gene: TP53
Feedback?
Variant information Variant position: help 323 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help US The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Leucine (L) to Valine (V) at position 323 (L323V, p.Leu323Val). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and hydrophobic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In a sporadic cancer; somatic mutation. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 323 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 393 The length of the canonical sequence.
Location on the sequence: help STKRALPNNTSSSPQPKKKP L DGEYFTLQIRGRERFEMFRE The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         STKRALPNNTS-SSPQPK--KKPL----DGEYFTLQIRGRERFEMFRE

                              STKRALPPSTS-SSPPQK--KKPL----DGEYFTLQIRGRE

Rhesus macaque                STKRALPNNTS-SSPQPK--KKPL----DGEYFTLQIRGRE

Mouse                         SAKRALPTCTS-ASPPQK--KKPL----DGEYFTLKIRGRK

Rat                           SAKRALPTSTS-SSPQQK--KKPL----DGEYFTLKIRGRE

Pig                           STKRALPTSTS-SSPVQK--KKPL----DGEYFTLQIRGRE

Bovine                        STKRALPTNTS-SSPQPK--KKPL----DGEYFTLQIRGFK

Rabbit                        SSKRALPTTTTDSSPQTK--KKPL----DGEYFILKIRGRE

Sheep                         STKRALPSSTS-SSPQQK--KKPL----DGEYFTLQIRGRK

Cat                           STKRALPPSTS-STPPQK--KKPL----DGEYFTLQIRGRE

Chicken                       VAKRAMSPPTE-APEPPK--KRVL--NPDNEIFYLQVRGRR

Xenopus laevis                KRELAHPPSSE--PPLPK--KRLVVVDDDEEIFTLRIKGRS

Zebrafish                     TKRSLVKESSS-ATLRPEGSKKAKGSSSDEEIFTLQVRGRE

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 393 Cellular tumor antigen p53
Region 100 – 370 Interaction with HIPK1
Region 282 – 325 Disordered
Region 300 – 393 Interaction with CARM1
Region 319 – 360 Interaction with HIPK2
Modified residue 305 – 305 N6-acetyllysine
Modified residue 315 – 315 Phosphoserine; by AURKA, CDK1 and CDK2
Modified residue 321 – 321 N6-acetyllysine
Modified residue 333 – 333 Omega-N-methylarginine; by PRMT5
Modified residue 335 – 335 Symmetric dimethylarginine; by PRMT5
Modified residue 337 – 337 Symmetric dimethylarginine; by PRMT5
Mutagenesis 319 – 319 K -> A. Loss of nuclear localization; when associated with A-320 and A-321.
Mutagenesis 320 – 320 K -> A. Loss of nuclear localization; when associated with A-319 and A-321.
Mutagenesis 321 – 321 K -> A. Loss of nuclear localization; when associated with A-319 and A-320.
Helix 322 – 324



Literature citations
No reference for the current variant in UniProtKB/Swiss-Prot.
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.