UniProtKB/Swiss-Prot Q13627: Variant p.Ala679Pro

Dual specificity tyrosine-phosphorylation-regulated kinase 1A
Gene: DYRK1A
Feedback?

Variant information Variant position:

679 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Alanine (A) to Proline (P) at position 679 (A679P, p.Ala679Pro). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from small size and hydrophobic (A) to medium size and hydrophobic (P) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Other resources:

Links to websites of interest for the variant.

Variant rs55720916 [ dbSNP | Ensembl ]

Sequence information Variant position:

679 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

763 The length of the canonical sequence.
Location on the sequence:

SSSTTSSSTSSSSTGNQGNQ A YQNRPVAANTLDFGQNGAMD The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         SSSTTSSSTSSSSTGNQGNQAYQNRPVAANTLDFGQNGAMD

Mouse                         SSSTTSSSTSSSSTGNQGNQAYQNRPVAANTLDFGQNGAMD

Rat                           SSSTTSSSTSSSSTGNQGNQAYQNRPVAANTLDFGQNGAMD

Xenopus laevis                SSSTTSSSTSSSSTGNQGNQAYQNRPVAANTLDFGQNGTLD

Xenopus tropicalis            SSSTTSSSTSSSSTGNQGNQAYQNRPVAANTLDFGQNGTMD

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 763	Dual specificity tyrosine-phosphorylation-regulated kinase 1A
Region	596 – 679	Disordered
Compositional bias	627 – 679	Polar residues
Alternative sequence	526 – 763	Missing. In isoform 3.
Alternative sequence	530 – 763	Missing. In isoform 2.
Alternative sequence	585 – 763	Missing. In isoform 4.

Literature citations
Isolation of human and murine homologues of the Drosophila minibrain gene: human homologue maps to 21q22.2 in the Down syndrome 'critical region'.
Song W.J.; Sternberg L.R.; Kasten-Sportes C.; van Keuren M.L.; Chung S.H.; Slack A.C.; Miller D.E.; Glover T.W.; Chiang P.W.; Lou L.; Kurnit D.W.;
Genomics 38:331-339(1996)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM LONG); VARIANT PRO-679; TISSUE SPECIFICITY; Patterns of somatic mutation in human cancer genomes.
Greenman C.; Stephens P.; Smith R.; Dalgliesh G.L.; Hunter C.; Bignell G.; Davies H.; Teague J.; Butler A.; Stevens C.; Edkins S.; O'Meara S.; Vastrik I.; Schmidt E.E.; Avis T.; Barthorpe S.; Bhamra G.; Buck G.; Choudhury B.; Clements J.; Cole J.; Dicks E.; Forbes S.; Gray K.; Halliday K.; Harrison R.; Hills K.; Hinton J.; Jenkinson A.; Jones D.; Menzies A.; Mironenko T.; Perry J.; Raine K.; Richardson D.; Shepherd R.; Small A.; Tofts C.; Varian J.; Webb T.; West S.; Widaa S.; Yates A.; Cahill D.P.; Louis D.N.; Goldstraw P.; Nicholson A.G.; Brasseur F.; Looijenga L.; Weber B.L.; Chiew Y.-E.; DeFazio A.; Greaves M.F.; Green A.R.; Campbell P.; Birney E.; Easton D.F.; Chenevix-Trench G.; Tan M.-H.; Khoo S.K.; Teh B.T.; Yuen S.T.; Leung S.Y.; Wooster R.; Futreal P.A.; Stratton M.R.;
Nature 446:153-158(2007)
Cited for: VARIANT [LARGE SCALE ANALYSIS] PRO-679;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.