UniProtKB/Swiss-Prot Q9UQ84: Variant p.Ser610Gly

Exonuclease 1
Gene: EXO1
Feedback?

Variant information Variant position:

610 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Serine (S) to Glycine (G) at position 610 (S610G, p.Ser610Gly). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from small size and polar (S) to glycine (G) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Polymorphism:

Most naturally occurring variants in this protein are not associated with familial disposition to hereditary non-polyposis colorectal cancer (HNPCC) (PubMed:12517792). Furthermore, germline deletions involving this locus are not associated with clinically manifested colorectal tumors (PubMed:14623461). Additional information on the polymorphism described.
Other resources:

Links to websites of interest for the variant.

Variant rs12122770 [ dbSNP | Ensembl ]

Sequence information Variant position:

610 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

846 The length of the canonical sequence.
Location on the sequence:

SSKFTRTISPPTLGTLRSCF S WSGGLGDFSRTPSPSPSTAL The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         SSKFTRTISPPTLGTLRSCFSWSGGL----------------------------------------------------GDFSRTPSPSPSTAL

Mouse                         TSKLLGAMSPPSLGTLRSCFSWSGTL---------------

Xenopus laevis                -----QRISP--LQNQRSCFTWSGSL---------------

Zebrafish                     -----PSCSSRPASVGLGVFSWSGTT---------------

Drosophila                    -NPIRQRCSSQISDGETDTDTTASSL---------------

Slime mold                    VSQSRKSFSSPTLSNNEDYDSSFVSSTIPSSIGDDYDQMNS

Baker's yeast                 -----------------STTSFPGSS---------------

Fission yeast                 ---------------------WFSSF---------------

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 846	Exonuclease 1
Region	600 – 846	Interaction with MSH2
Modified residue	598 – 598	Phosphoserine
Modified residue	610 – 610	Phosphoserine
Modified residue	621 – 621	Phosphothreonine
Modified residue	623 – 623	Phosphoserine
Mutagenesis	621 – 621	T -> A. No rescue of HU-induced degradation. No rescue of HU-induced degradation; when associated with A-714. Loss of HU-sensitivity and resistance to HU-induced degradation; when associated with A-454 and A-714.

Literature citations
Germline mutations of EXO1 gene in patients with hereditary nonpolyposis colorectal cancer (HNPCC) and atypical HNPCC forms.
Wu Y.; Berends M.J.W.; Post J.G.; Mensink R.G.J.; Verlind E.; van der Sluis T.; Kempinga C.; Sijmons R.H.; van der Zee A.G.J.; Hollema H.; Kleibeuker J.H.; Buys C.H.C.M.; Hofstra R.M.W.;
Gastroenterology 120:1580-1587(2001)
Cited for: VARIANTS ALA-27; LYS-109; ARG-410; GLY-610; ALA-640; SER-640; GLU-759 AND LEU-770; EXO1 variants occur commonly in normal population: evidence against a role in hereditary nonpolyposis colorectal cancer.
Jagmohan-Changur S.; Poikonen T.; Vilkki S.; Launonen V.; Wikman F.; Orntoft T.F.; Moeller P.; Vasen H.; Tops C.; Kolodner R.D.; Mecklin J.-P.; Jaervinen H.; Bevan S.; Houlston R.S.; Aaltonen L.A.; Fodde R.; Wijnen J.; Karhu A.;
Cancer Res. 63:154-158(2003)
Cited for: VARIANTS SER-137; ARG-410; CYS-438; GLY-610; ALA-640; SER-640; GLU-759 AND VAL-827;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.