Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q9NZV5: Variant p.Gly315Ser

Selenoprotein N
Gene: SELENON
Feedback?
Variant information Variant position: help 315 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Glycine (G) to Serine (S) at position 315 (G315S, p.Gly315Ser). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from glycine (G) to small size and polar (S) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In CMYP3. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 315 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 590 The length of the canonical sequence.
Location on the sequence: help EFQLSEPPDFPFWFSPAQFT G HIILSKDATHVRDFRLFVPN The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         EFQLSEPPDFPFWFSPAQFTGHIILSKDATHVRDFRLFVPN

Mouse                         EFQLSEPPDFPFWFSPGQFTGHIILSKDATHIRDFRLFVPN

Xenopus tropicalis            EFQLNEPPNFPFWFSPGQFTGNIVISKDAAHVRHFKLFVPN

Zebrafish                     EFQLNDVPDFPFWFTPGQFAGHIILSKDASHVRDFHIYVPN

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 44 – 590 Selenoprotein N



Literature citations
SEPN1: associated with congenital fiber-type disproportion and insulin resistance.
Clarke N.F.; Kidson W.; Quijano-Roy S.; Estournet B.; Ferreiro A.; Guicheney P.; Manson J.I.; Kornberg A.J.; Shield L.K.; North K.N.;
Ann. Neurol. 59:546-552(2006)
Cited for: INVOLVEMENT IN CMYP3; VARIANT CMYP3 SER-315; Mutations of the selenoprotein N gene, which is implicated in rigid spine muscular dystrophy, cause the classical phenotype of multiminicore disease: reassessing the nosology of early-onset myopathies.
Ferreiro A.; Quijano-Roy S.; Pichereau C.; Moghadaszadeh B.; Goemans N.; Boennemann C.; Jungbluth H.; Straub V.; Villanova M.; Leroy J.-P.; Romero N.B.; Martin J.-J.; Muntoni F.; Voit T.; Estournet B.; Richard P.; Fardeau M.; Guicheney P.;
Am. J. Hum. Genet. 71:739-749(2002)
Cited for: VARIANTS CMYP3 ARG-293; SER-315; ILE-340; SER-453; GLY-462 AND GLN-466; Desmin-related myopathy with Mallory body-like inclusions is caused by mutations of the selenoprotein N gene.
Ferreiro A.; Ceuterick-de Groote C.; Marks J.J.; Goemans N.; Schreiber G.; Hanefeld F.; Fardeau M.; Martin J.-J.; Goebel H.H.; Richard P.; Guicheney P.; Bonnemann C.G.;
Ann. Neurol. 55:676-686(2004)
Cited for: VARIANT CMYP3 SER-315; Rigid spine muscular dystrophy due to SEPN1 mutation presenting as cor pulmonale.
Venance S.L.; Koopman W.J.; Miskie B.A.; Hegele R.A.; Hahn A.F.;
Neurology 64:395-396(2005)
Cited for: VARIANT CMYP3 SER-315;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.