UniProtKB/Swiss-Prot Q9Y5N1: Variant p.Ala280Val

Histamine H3 receptor
Gene: HRH3
Feedback?

Variant information Variant position:

280 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

US The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Alanine (A) to Valine (V) at position 280 (A280V, p.Ala280Val). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from small size and hydrophobic (A) to medium size and hydrophobic (V) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Variant description:

In a Shy-Drager syndrome patient; uncertain significance. Any additional useful information about the variant.
Other resources:

Links to websites of interest for the variant.

Variant rs752380770 [ dbSNP | Ensembl ]

Sequence information Variant position:

280 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

445 The length of the canonical sequence.
Location on the sequence:

GCWQKGHGEAMPLHRYGVGE A AVGAEAGEATLGGGGGGGSV The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         GCWQKGHGEAMPLHRYGVGEAAVGAEAGEATLGGGGGGGSV

Mouse                         GCWPKGHGEAMPLHRYGVGEAGPGVETGEAGLGGGSGGGAA

Rat                           GCWPKGHGEAMPLHRYGVGEAGPGVEAGEAALGGGSGGGAA

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 445	Histamine H3 receptor
Topological domain	218 – 359	Cytoplasmic
Alternative sequence	197 – 315	Missing. In isoform 5.
Alternative sequence	227 – 342	Missing. In isoform 6.
Alternative sequence	274 – 353	Missing. In isoform 3.

Literature citations
Structure of the human histamine H3 receptor gene (HRH3) and identification of naturally occurring variations.
Wiedemann P.; Boenisch H.; Oerters F.; Bruess M.;
J. Neural Transm. 109:443-453(2002)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; VARIANT VAL-280;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.