Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q13315: Variant p.Ala2274Thr

Serine-protein kinase ATM
Gene: ATM
Feedback?
Variant information Variant position: help 2274 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help US The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Alanine (A) to Threonine (T) at position 2274 (A2274T, p.Ala2274Thr). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from small size and hydrophobic (A) to medium size and polar (T) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In B-cell chronic lymphocytic leukemia; uncertain significance; no effect on phosphorylation of target proteins. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 2274 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 3056 The length of the canonical sequence.
Location on the sequence: help HLVELSILARTFKNTQLPER A IFQIKQYNSVSCGVSEWQLE The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         HLVELSILAR----------TFKNTQLPERAIFQI-KQY--NSVSCGVS-EWQLE

Mouse                         HLVEFSVLAR----------TFKNTQLPERAIFKI-KQY--

Pig                           HLVELSLLAR----------TFQNTQLPERAIFQI-KQY--

Caenorhabditis elegans        KLAEMLTEN---------------------------KAY--

Drosophila                    YLMKGIEECK----------SAGKLNLAAKYTATL-REL--

Baker's yeast                 SIIQLANYVQLAIANGAPQDALRNATLMSKTVKNIAKLYDD

Fission yeast                 YILELLKISESFLIVDNLQNAFSVAMLSDALY----RKF--

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 2 – 3056 Serine-protein kinase ATM
Domain 1940 – 2566 FAT
Helix 2269 – 2281



Literature citations
Inactivation of ataxia telangiectasia mutated gene in B-cell chronic lymphocytic leukaemia.
Stankovic T.; Weber P.; Stewart G.; Bedenham T.; Murray J.; Byrd P.J.; Moss P.A.H.; Taylor A.M.R.;
Lancet 353:26-29(1999)
Cited for: POSSIBLE INVOLVEMENT IN BCLL; VARIANTS THR-350; THR-352; ARG-1054; THR-2274 AND ALA-2695; Modeling ATM mutant proteins from missense changes confirms retained kinase activity.
Barone G.; Groom A.; Reiman A.; Srinivasan V.; Byrd P.J.; Taylor A.M.;
Hum. Mutat. 30:1222-1230(2009)
Cited for: FUNCTION; CHARACTERIZATION OF VARIANTS AT LEU-292; PRO-1465; ILE-1743; THR-2274; GLY-2424; 2427-LEU-ARG-2428 DEL; 2546-SER--ILE-2548 DEL; ASP-2554; GLY-2668; CYS-2827; 2855-SER-VAL-2856 DELINS ARG-ILE AND CYS-3008; CHARACTERIZATION OF VARIANTS VAL-546; ARG-1054; ILE-1322; ARG-1691; CYS-1961 AND SER-2765; VARIANT ILE-1322; MUTAGENESIS OF LYS-1807; VAL-1941; TYR-2019; GLU-2039; LEU-2338; SER-2394; LEU-2452; SER-2685; PRO-2699; ASP-2708 AND GLN-2730;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.