UniProtKB/Swiss-Prot Q13315: Variant p.Leu1910His

Serine-protein kinase ATM
Gene: ATM
Feedback?

Variant information Variant position:

1910 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

US The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Leucine (L) to Histidine (H) at position 1910 (L1910H, p.Leu1910His). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from medium size and hydrophobic (L) to medium size and polar (H) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Variant description:

In T-prolymphocytic leukemia. Any additional useful information about the variant.

Sequence information Variant position:

1910 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

3056 The length of the canonical sequence.
Location on the sequence:

DSESEHFFRCCLDKKSQRTM L AVVDYMRRQKRPSSGTIFND The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         DSESEHFFRCCLDKKSQRTMLAVVDYMRRQKRPSSGTIFND

Mouse                         DSESENFLRCCLDKKSQRTMLAVVDYLRRQKRPSSGTAFDD

Pig                           DSESEHVFRCHLDKKSQRTMLAVVDYMRRQKRSSSGTVFDD

Caenorhabditis elegans        NAEDEIVVRCLAECVDSIGLNVIARYERLNIETHSEFGVK-

Drosophila                    --NSQEIFR---NKRAIKKFLHICEYIR---------IFNN

Baker's yeast                 ----AMLLHVKDSEIKLKMLFNVIKMIRMGSRCKERNCLR-

Fission yeast                 NKNTNSIRKTC---------MNILLYLRRQLGHHALNPFEA

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	2 – 3056	Serine-protein kinase ATM
Modified residue	1893 – 1893	Phosphoserine; by autocatalysis
Mutagenesis	1893 – 1893	S -> A. Loss of IR-induced S-1893 autophosphorylation. Reduced correction of cell cycle checkpoint defects and DNA-repair activity. No effect on S-367 nor S-1981 autophosphorylation.
Helix	1903 – 1917

Literature citations
Clustering of missense mutations in the ataxia-telangiectasia gene in a sporadic T-cell leukaemia.
Vorechovsky I.; Luo L.; Dyer M.J.S.; Catovsky D.; Amlot P.L.; Yaxley J.C.; Foroni L.; Hammarstroem L.; Webster A.D.B.; Yuille M.A.R.;
Nat. Genet. 17:96-99(1997)
Cited for: POSSIBLE INVOLVEMENT IN TPLL AND BNHL; VARIANTS VAL-1040; THR-1407; SER-1463; HIS-1682; HIS-1910; LYS-2164; SER-2396; GLY-2424; PRO-2442; 2546-SER--ILE-2548 DEL; ALA-2695; ARG-2722; VAL-2725; LEU-2732; LYS-2810 DEL; CYS-2832 AND 2871-ARG-HIS-2872 DELINS SER AND VAL-2890;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.