Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q99972: Variant p.Gly367Arg

Myocilin
Gene: MYOC
Feedback?
Variant information Variant position: help 367 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Glycine (G) to Arginine (R) at position 367 (G367R, p.Gly367Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from glycine (G) to large size and basic (R) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In GLC1A. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 367 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 504 The length of the canonical sequence.
Location on the sequence: help YELNTETVKAEKEIPGAGYH G QFPYSWGGYTDIDLAVDEAG The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         YELNTETVKAEKEIPGA------GYHGQFPYSWGGYTDIDLAVDE---------------AG

                              YELTAETVKAEREIPGA------GYHGQFPYSWGGYTDIDL

Mouse                         YELDTETVKAEKEIPGA------GYHGHFPYAWGGYTDIDL

Rat                           YELNTETVKAEKEIPGA------GYHGQFPYAWGGYTDIDL

Bovine                        YDLRTETLKAEKEIPGA------GYHGQFPYSWGGYTDIDL

Rabbit                        FELNTETVKAEKEIPGA------GYRGQFPYSWGGYTDIDL

Cat                           YELNTETVKAEKEIPGA------GYHGQFPYSWGGYTDIDL

Slime mold                    TEFKTELVALINKQKGTTLAVNFGQSIQYFKKKGSNNTVTF
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 33 – 504 Myocilin
Chain 227 – 504 Myocilin, C-terminal fragment
Domain 244 – 503 Olfactomedin-like
Binding site 380 – 380
Disulfide bond 245 – 433
Beta strand 366 – 369



Literature citations
Mutations in the TIGR gene in familial primary open-angle glaucoma in Japan.
Suzuki Y.; Shirato S.; Taniguchi F.; Ohara K.; Nishimaki K.; Ohta S.;
Am. J. Hum. Genet. 61:1202-1204(1997)
Cited for: VARIANTS GLC1A ARG-367 AND LEU-370; Juvenile open angle glaucoma: fine mapping of the TIGR gene to 1q24.3-q25.2 and mutation analysis.
Michels-Rautenstrauss K.G.; Mardin C.Y.; Budde W.M.; Liehr T.; Polansky J.R.; Nguyen T.; Timmerman V.; van Broeckhoven C.; Naumann G.O.H.; Pfeiffer R.A.; Rautenstrauss B.W.;
Hum. Genet. 102:103-106(1998)
Cited for: VARIANTS GLC1A ARG-367 AND LEU-370; Novel mutations in the TIGR gene in early and late onset open angle glaucoma.
Mansergh F.C.; Kenna P.F.; Ayuso C.; Kiang A.-S.; Humphries P.; Farrar G.J.;
Hum. Mutat. 11:244-251(1998)
Cited for: VARIANTS GLC1A ARG-367 AND PHE-426; Digenic inheritance of early-onset glaucoma: CYP1B1, a potential modifier gene.
Vincent A.L.; Billingsley G.; Buys Y.; Levin A.V.; Priston M.; Trope G.; Williams-Lyn D.; Heon E.;
Am. J. Hum. Genet. 70:448-460(2002)
Cited for: VARIANTS GLC1A ARG-252; LYS-293; ARG-367; LEU-370; LYS-377; VAL-399 AND VAL-445; VARIANT ARG-398; Founder TIGR/myocilin mutations for glaucoma in the Quebec population.
Faucher M.; Anctil J.-L.; Rodrigue M.-A.; Duchesne A.; Bergeron D.; Blondeau P.; Cote G.; Dubois S.; Bergeron J.; Arseneault R.; Morissette J.; Raymond V.;
Hum. Mol. Genet. 11:2077-2090(2002)
Cited for: VARIANTS GLC1A TRP-126; LYS-293; LYS-352; ARG-367; GLU-423; THR-427; VAL-445 AND LEU-481; VARIANTS LYS-76; GLU-77 AND ARG-398; Novel mutations in the MYOC/GLC1A gene in a large group of glaucoma patients.
Michels-Rautenstrauss K.; Mardin C.; Wakili N.; Juenemann A.M.; Villalobos L.; Mejia C.; Soley G.C.; Azofeifa J.; Oezbey S.; Naumann G.O.H.; Reis A.; Rautenstrauss B.;
Hum. Mutat. 20:479-480(2002)
Cited for: VARIANTS GLC1A ALA-251; MET-345; ARG-367; LEU-370; ASN-393; SER-434; ASP-450 AND CYS-470; VARIANT LYS-76; Myocilin analysis by DHPLC in French POAG patients: increased prevalence of Q368X mutation.
Melki R.; Belmouden A.; Brezin A.; Garchon H.-J.;
Hum. Mutat. 22:179-179(2003)
Cited for: VARIANTS GLC1A ARG-367; ILE-438; LYS-480 AND PHE-499; VARIANTS SER-57; LYS-76 AND ARG-398;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.